SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7DLN9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7DLN9
Domain Number 1 Region: 460-639
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-51
Family SPRY domain 0.00085
Further Details:      
 
Domain Number 2 Region: 6-77
Classification Level Classification E-value
Superfamily RING/U-box 8.62e-18
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 3 Region: 157-217
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000229
Family B-box zinc-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7DLN9
Sequence length 641
Comment (tr|F7DLN9|F7DLN9_MONDO) Tripartite motif containing 25 {ECO:0000313|Ensembl:ENSMODP00000018527} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=TRIM25 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MAELQLTEEMTCSICLELFHHPVTIPCGHNFCSPCLNETWTVQGPPFYCPQCRTSFLTRP
QLQKNTALCSVVDHLQQIQSRQELGSLCEEAKRGESWDLPSRKEGQGKEAEAVSVACDHC
LQAPAAKTCFTCMASFCQEHLRPHLDNPAFQGHALQQPVPDLARRKCAEHSRLREFFCPQ
HGACICCVCLVGHKTCSPVALDIARNDLKSKMKQKLTTAYDDINKASSALKDVKLKQLAV
QETAARKIDLLKREYEEMKTLIESEEKRALRKLKEEEKRVLDKYDYVHQVLLKKKKEIEF
VKEEIELLLTKDDEIAFLEKASKLQEILIKSVYVPKNELNQEMINGVYQHAFSLKEALKH
NITHLQEKKTEEATSSDDSGKPSSSFRPAYPTKDHYQTRRIQTPVPAATPSQKPSLGTMP
DLADLKTALSDTTEKGAAALPKNSPTRKTQILETFLAKSRPELLQYATQVVLDFNTAHNK
VALSENYTVASVATVPQNYRPHPQRFTFCSQVLGLHGYKRGVHYWEVELQKNTFCGIGIC
YASMDRQGPDSRLGRNNSSWCVEWFNTKISTWHNDVEKNLPLTKATRIGVLLNCDDGFVI
FFAITDKVSLIYKYKVEFSEVVYPAFWVFSSGTTLSICSLK
Download sequence
Identical sequences F7DLN9
ENSMODP00000018527 ENSMODP00000018527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]