SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7DNQ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7DNQ9
Domain Number 1 Region: 57-524
Classification Level Classification E-value
Superfamily Cytochrome P450 7.86e-119
Family Cytochrome P450 0.00000957
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7DNQ9
Sequence length 541
Comment (tr|F7DNQ9|F7DNQ9_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000018351} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=LOC100013399 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MVPGSEWLSHQLGLGGLKSGVHSVMILFFLALSTWILAQVLFFLNRYYTNIQQLRCFPQP
LIWNWFSGHLGLMDFTEKSLIRIIDYVSTFREVFLMWMGPFRPVIVLCHSDYIRPLTSAS
AHIAPKDNFIYGFLKPWLGDGLLLSGGDKWSRHRRLLTPAFHFDILKPYVKIFNQCADIM
HEKWKRLCAEESTQLDVFDHVSLMTLDTLQKCIFSHNSNCQEKPSKYISTILELSVLSTK
RSNQFFLYWDSVYYLTSQGRSFTQACHLVHDFTDAVIKARQKVLAEQGVEAFLKDKGKGK
TMDFIDILLLSKDEDGKPLSDKDIRAEADTFMFEGHDTTASGISWVLYNLAQHQEYQDRC
RQEIQELMKGRETEEIEWNDLSQMPFLTMCIKESLRLHPPVPIIFRQCTKDIQLPDSRVI
PKGSVCLISIFGTHHNPTVWPNPEVYDPYRFDTNNPQKMSPLAFMPFSAGPRNCIGQNFA
MSEMKVVLALTLLRFRVFPHGNPPRRKLELVLRTESGLWLKVEPVQHSSSSEADLQEAPQ
N
Download sequence
Identical sequences F7DNQ9
XP_007489770.1.35504 XP_007489771.1.35504 XP_007489772.1.35504 ENSMODP00000018351 ENSMODP00000018351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]