SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7DZF6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7DZF6
Domain Number 1 Region: 614-874
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.75e-80
Family Eukaryotic proteases 0.0000991
Further Details:      
 
Domain Number 2 Region: 280-382
Classification Level Classification E-value
Superfamily SRCR-like 8.37e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000582
Further Details:      
 
Domain Number 3 Region: 498-599
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000762
Further Details:      
 
Domain Number 4 Region: 387-488
Classification Level Classification E-value
Superfamily SRCR-like 4.97e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00014
Further Details:      
 
Domain Number 5 Region: 167-270
Classification Level Classification E-value
Superfamily SRCR-like 2.22e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0012
Further Details:      
 
Domain Number 6 Region: 100-171
Classification Level Classification E-value
Superfamily Kringle-like 3.38e-16
Family Kringle modules 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7DZF6
Sequence length 875
Comment (tr|F7DZF6|F7DZF6_MACMU) Neurotrypsin {ECO:0000313|Ensembl:ENSMMUP00000020010} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=PRSS12 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MTLARFVLALVLRALPEVVGFDSVLNDSLHHRHRHSPPPGPQYPYYLPTHQRPPRTRPPP
PLPRFPRPPRALPAQRPHALQAGHTPRPHPWGCPAGELWVSVTDFGAPCLRWAEVPPFLE
RSPPANWAQLRGQRHNFCRSPDGTGRPWCFYGDARGKVDWGYCDCRHGSVRLRGGKNEFE
GTVEVYASGAWGTVCSSHWDDSDASVICHQLQLGGKGIAKQTPFSGLGLIPIYWSNVRCR
GDEENILLCEKDIWQGGVCPQKMAAAVTCSFSRGPAFPIIRLVGGSSVHEGRVELYHAGQ
WGTICDDQWDDADAEVICRQLGLSGIAKAWHQAYFGEGSGPVMLDEVRCTGNELSIEQCP
KSSWGEHNCGHKEDAGVSCTPLTDGVIRLAGGKGSHEGRLEVYYRGQWGTVCDDGWTELN
TYVVCRQLGFKYGKQASANHFEESTGPIWLDDVSCSGKETRFLQCSRRQWGQHDCSHHED
VSIACYPGSEGHRLSLGFPVRLMDGENKKEGRVEVFINGQWGTICDDGWTDKDAAVICRQ
LGYKGPARARTMAYFGEGKGPIHVDNVKCTGNERSLADCIKQDIGRHNCRHSEDAGVICD
YFGKKASGNSNKESLSSVCGLRLLHRRQKRIIGGKNSLRGGWPWQVSLRLKSSHGDGRLL
CGATLLSSCWVLTAAHCFKRYGNSTRNYAVRVGDYHTLVPEEFEEEIGVQQIVIHREYRP
DSSDYDIALVRLQGPEEQCARFSSHVLPACLPFWRERPQKTASNCYITGWGDTGRAYSRT
LQQAAIPLLPKRFCEERYKGRFTGRMLCAGNLHEHKRVDSCQGDSGGPLMCERPGESWAV
YGVTSWGYGCGVKDSPGVYTKVSAFVPWIKSVTKL
Download sequence
Identical sequences F7DZF6
9544.ENSMMUP00000020010 NP_001121559.2.72884 ENSMMUP00000020010 ENSMMUP00000020010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]