SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7E0X7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7E0X7
Domain Number 1 Region: 691-837
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.07e-40
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 1017-1117
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.24e-30
Family Ras-binding domain, RBD 0.00079
Further Details:      
 
Domain Number 3 Region: 216-372
Classification Level Classification E-value
Superfamily PH domain-like 4.71e-22
Family Phosphotyrosine-binding domain (PTB) 0.014
Further Details:      
 
Domain Number 4 Region: 11-100
Classification Level Classification E-value
Superfamily PDZ domain-like 9.85e-20
Family PDZ domain 0.0097
Further Details:      
 
Domain Number 5 Region: 962-1031
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000251
Family Ras-binding domain, RBD 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7E0X7
Sequence length 1424
Comment (tr|F7E0X7|F7E0X7_HORSE) Regulator of G protein signaling 12 {ECO:0000313|Ensembl:ENSECAP00000017668} KW=Complete proteome; Reference proteome OX=9796 OS=Equus caballus (Horse). GN=RGS12 OC=Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
Sequence
MYRAGDTAERPLHGTAPPRMRSVEVARGRAGYGFTLSGQAPCVLSCVMRGSPADFVGLRA
GDQIFAVNEINVKKASHEDVVKLIGKCSGVLHMVIGEGISHLESCSSDEEVGFYEGKGWL
RPKLDSKALGINRAERVVEEMQSGGIFNMIFENPSLCASSSEPLKLKQRSLSESAAARFD
LGHECINNRTSNLLSKEEIAKVINDDSVFTIGLENHEDFGLDASILNVAMVVGYLGSIEL
PSTSCNLESDSLQAIRGCLRRLRAEQKIHSLVTMKIMHDCVQLCTDKAAVLAEYPAEKLA
FSAVCPDDRRFFGLVTMQTSDDGSLAQEDEGVLRTSCHVFMVDPDLFNHKIHQGIARRFG
FECTADPDTNGCLEFPASSLPVLQFISVLYRDMGELIEGVRARAFVDGDADAHQNTSTSS
NSDSGIGNFNQEEKSSRVLVVDLGASSGRHGASSSTWEGVGGRGSQPWGAPWNGAFSHDP
EGGPLFEAASQGDRCRDFTKHLGPASHVEVPPASLRNSVPPSKRGAVGPGGGFGQRWLPV
HVLQEWQCGHASDQESYTDSTDGWSSVNCGTLPPPMSKIPADRYRVEGSLVQPLLSAQKR
DWSRKAFGMQNIFGPHRNVRKTKEDKKGSKFGRGIGLPQTSQRTSARRSFGRSKRFSITR
SLDDLESATVSDGELNGADLKDCVSNHSLSSNASLPSVQSCRRLRERRVASWAVSFERLL
QDPLGVRYFSDFLRKEFSEENILFWQACEYFNHVPAHDKKELSYRAREIFSKFLCSKATT
PVNIDSQAQLADDILSAPHPDMFKEQQLQIFNLMKFDSYTRFLKSQLYQECILAEVEGRS
LPDSQQVPSSPASKHSISSDHSNVSTPKKLSGKSKSGRSLNEELGDEDSEKKRKGAFFSW
SRTRSTGRSQKKKDHSDHPNDPLHANGGLGRRESQGSVSSAGSLDLSEACRTSAPERDKA
AKHCCIQLPDGTSCVVLVKAGLSIKEVLSGLCERHGINGAAVDLFLVGGDKPLVLHQDSS
ILESRDLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLHLSELVARLSG
EKEPLDLGAPISSLDGQRVILEERDPSRGKVSTDKQKSAAVKQNIAVNASSRNHSATGEE
RTLGKSNSIKIKGENGKNARDPRLSKREESIAKIGKKKYQKINLDEAEEFFELISKAQSN
RADDQRGLLRKEDLVLPEFLRLPPSPTELALSSPPTAKGFGKRTAAAAGHGREEAPQPRE
PQGPARDCRDSPATSPGSADSPPFSAPLTPTPRAQEVEAGGVQTVEGEHGADLTLTGEGD
ISSPNSTLLPPPPAPQDPTPQDPAGPPRPGGGARGSRGLPVSTIIDVDRVAGLAPGLGGS
VSGVRTGPRRSRASGPPTSDLPGLSSIPDRPAKPKASPHHATFV
Download sequence
Identical sequences F7E0X7
ENSECAP00000017668 XP_001488901.2.31192 9796.ENSECAP00000017668 ENSECAP00000017668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]