SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7E2U1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7E2U1
Domain Number 1 Region: 327-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.85e-16
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 598-648
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000233
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 681-733
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000025
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 641-685
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000328
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 483-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000239
Family Classic zinc finger, C2H2 0.043
Further Details:      
 
Domain Number 6 Region: 566-609
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000239
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 7 Region: 448-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000495
Family Classic zinc finger, C2H2 0.055
Further Details:      
 
Weak hits

Sequence:  F7E2U1
Domain Number - Region: 49-78
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00243
Family C2HC finger 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7E2U1
Sequence length 849
Comment (tr|F7E2U1|F7E2U1_MONDO) Zinc finger protein 341 {ECO:0000313|Ensembl:ENSMODP00000003467} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=ZNF341 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MAQTIFEALEGIDNQTVLAVQSLWDGQGAVPDPTPQSVNTPATIQSLDDEDVFLCGKCKK
QFNSLPAFMTHKREQCQGSAPALAAVSLATNSIYAPSVTSVQQAPPANRQQISTYITVPP
SPLIQTLVQGNILVSDEVLMSAMSAFTSLDQPMPPVQPPVQPPVQSSLSMHSGPGYLPQP
PPPPPPPPPLPPPPPPQPPPPPPPPPPSQNLGAPGRPSTGGSGVIEVYNATAPLAGSSVV
EIQALGMQPYPSLEVPNQCVENPVYPSPPVYSPGKQGFKPKGPTPPAPLTNTTSGNVAVF
NSSSTLKTQRPKIDGGLQEGKPKCQKLKCTYCDKTFTKNFDLQQHIRSHTGEKPFQCIVC
GRAFAQKSNVKKHMQTHKVWPPGHGCTISRNSVTVQVMALNPTQQEDEEDPGISQPPRSV
PQPQALASAEENEAGKLEAKQVVLIDSSYQCQFCPNKFSTYFQLRSHMTQHKNEQVYKCV
VKSCAQMFQKLDMFLEHIKSHQEELSYRCHLCSKDFPSLYELGVHQYSHSLLPQHSPKKD
VAVYKCVKCVNKYSTPEALEHHLQTATHNFPCPHCQKVFPCERYLRRHLPTHGSGGKFKC
QICKKFFRREHYLKLHAHIHSGEKPFKCSVCDSAFNRKDKLKRHMLIHEPSKKYKCPFSM
HAGCNKEFNRPDKLKAHILSHSGMKIHNCQFCSKSFSRRAHLVEHQRSHTDNYKYRCSSC
AKGFTRHKYLKKHRCRLGPLKDKDPQACRPQKQRGARARKAAVPDPLGLEELKCNAEGAE
AGGSVKDPFPESDAVLSIVVGSSVGGEPELVVPGHSDNMGPNLTLAGLQSGAEGPCAMLA
VPVYIQTTE
Download sequence
Identical sequences F7E2U1
ENSMODP00000003467 XP_007474269.1.35504 ENSMODP00000003467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]