SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7E3L6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7E3L6
Domain Number 1 Region: 242-343
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.11e-29
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000114
Further Details:      
 
Domain Number 2 Region: 96-207
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.02e-16
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.032
Further Details:      
 
Domain Number 3 Region: 15-71
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000093
Family HLH, helix-loop-helix DNA-binding domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7E3L6
Sequence length 826
Comment (tr|F7E3L6|F7E3L6_CALJA) Hypoxia inducible factor 1 alpha subunit {ECO:0000313|Ensembl:ENSCJAP00000047757} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=HIF1A OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MEGASGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVM
RLTISYLRVRKLLDAGDLDIEDEMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYM
GLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGPVKKGKEQNTQRSFFLRMKCTLTSRGR
TMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSK
TFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQV
TTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECV
LKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTET
DDQQLEEVPLYNDVMLPSSNEKLQNINLSMSPLATSETPKPLRSSADPALNQEVALKLEP
NPESLELSFTMPQIQDQPPSPSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKLF
AEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTVT
VFQQTQIQELTSNATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKETTSATSSPYR
DTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRATVPEEELNPKILALQNAQRKR
KIEHDGSLFQAVGIGTLLQQPDDHATTTSLSWKRVKGCKSSEQNGMEQKAIILIPSDLAC
RLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
Download sequence
Identical sequences F7E3L6
ENSCJAP00000047757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]