SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7E5T3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7E5T3
Domain Number 1 Region: 517-608
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 4.19e-41
Family Small-conductance potassium channel 0.00000363
Further Details:      
 
Domain Number 2 Region: 386-558
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.9e-27
Family Voltage-gated potassium channels 0.004
Further Details:      
 
Weak hits

Sequence:  F7E5T3
Domain Number - Region: 29-102
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0288
Family beta-sandwich domain of Sec23/24 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7E5T3
Sequence length 704
Comment (tr|F7E5T3|F7E5T3_CALJA) Potassium calcium-activated channel subfamily N member 3 {ECO:0000313|Ensembl:ENSCJAP00000048251} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=KCNN3 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MDTSGHFHDSGVGDLDEDPKCPCPSSGDPPPPPPAPPAAPQQPPGPSLQPQPPQPPHPLS
QLAQLQSQPVHPGLLHSSPTAFRAPPSSNSTAILHPSSRQGSQLNLNDLLLGHSPSSTAT
SGPGGGSRHRQASPLVHRRDSNPFTEIAMSSCKYSGGVMKPLSRLSASRRNLIEAETEGQ
PLQLFSPSNPPEIVISSREDNHAHQTLLHHPNAHNHQHAGTTASSTTFPKANKRKNQNIG
YKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGLYSKDSMFSLALKCLISLST
IILLGLIIAYHTREVQLFVIDNGADDWRIAMTYERILYISLEMLVCAIHPIPGEYKFFWT
ARLAFSYTPSRAEADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNT
RFVMKTLMTICPGTVLLVFSISLWIIAAWTVRVCERYHDQQDVTSNFLGAMWLISITFLS
IGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKR
IKNAAANVLRETWLIYKHTKLLKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLSDQANT
LVDLSKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIADTLRQQQQQ
LLSAIIEARGVSVAVGTTHTPVSDSPIGVSSTSFPTPYTSSSSC
Download sequence
Identical sequences F7E5T3
ENSCJAP00000048251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]