SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7EED5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7EED5
Domain Number 1 Region: 954-1085,1148-1214
Classification Level Classification E-value
Superfamily Hemopexin-like domain 7.21e-39
Family Hemopexin-like domain 0.0009
Further Details:      
 
Domain Number 2 Region: 69-106
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000051
Family Somatomedin B domain 0.0011
Further Details:      
 
Domain Number 3 Region: 27-67
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000144
Family Somatomedin B domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7EED5
Sequence length 1214
Comment (tr|F7EED5|F7EED5_MACMU) Proteoglycan 4 {ECO:0000313|Ensembl:ENSMMUP00000011911} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=PRG4 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MAWKTLPIYLLLLLSVFVIQQVSSQDLSSCAGRCGEGYSRDATCNCDYNCQHYMECCPDF
KRVCTVELSCKGRCFESFERGRECDCDAQCKKYDKCCPDYESFCAEGKDNKKNRTKKKPT
PKPPVVDEAGSGLDNGDFKVTTTPATSTTQHNKVTTSPKITTAKPKNPRPSLPPNSDTSK
QTSLTTNKETTVETKEPTTTNKQTSTDGKETTSAKETQTKDLAPTSKVPAKPTPKAETTT
KGPALTTPKEPTPTTPKEPASTTPKEPAPTTTKSAPTTPKEPAPTTPKEPAPTTPKKPAP
IAPKEPSPTTTKKPAPTTPKEPLPTTTKEPAPTIPKEPAPTTPKEPATTTPKEPAPTTTK
EPAPTTPKEPSPTTPKELTPTTPKEPTPTPPKEPAPTTPKEPAPTPPKEPAPTTTKKPAP
TTPKEPGPTTPKEPAPTTTKKPAPTTPKELTPTTTKEPAPTTPKELTPTTTKKPAPTTPK
ELTPTTPEELTPTTPEEPTPTTPEEPTPTTPEEPAPTTPKAPAPTTPKEPAPKTAPTTPK
EPAPTTPKGTAPTTLKETAPTTPKETAPTTPKGTAPTTPKGTAPKTLKETAPTTPKGTAP
TTLNEPALTTPKQPAPKELAPTTTKEPTPTTSDKPAPTTPKEPAPTTSKKPAPTTPETPP
ATTSEASTPTTTMEPPTSHKSPDESTPELSAEPTPKVLENSSKKPSVPTTKTPAVTKSEM
TTIAKDKITERDIRTTPETTTVAPKMTKETATTTEKTTESKITTTATEVTSTTTQDTTPF
KITTFKTTTLAPKVTTTTKKTITTTEIMNKPEETAKPKDRATNSKATTAKPQKPTKAPKK
PTSTKKPTSTKKVRKPKTTPTPPKVTSTMPELNPTSRVAEAMLQTTTRPSQTPNSKLFEV
NPKNEDAGGAEGETPHMLPRPHVFTPIVIPGMDYSLRVPNQGIIINPMLSDETDICNGRP
VDGLTTLRNGTLVAFRGHYFWMLSPFSPPSPARRITEVWGIPSPIDTVFTRCNCEGKTFF
FKDSQYWRFTNDIKDAGYPKPIVKGFGGLTGQIVAALSIAKYKNRPESVYFFKRGGSIQQ
YIYKQEPVQKCPGRRPALNYPVYGETTQVRRRRFERAIGPSLTHTIRIHYSPVRLAYQDK
GFLHNEVKVSTLWRGLPNVVTSAISLPNIRKPDGYDYYAFSKDQYYNIDVPSRTARAITT
RSGQTLSKVWYNCP
Download sequence
Identical sequences F7EED5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]