SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7EFB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7EFB2
Domain Number 1 Region: 8-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-28
Family KRAB domain (Kruppel-associated box) 0.00083
Further Details:      
 
Domain Number 2 Region: 357-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.37e-27
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 245-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 301-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.49e-24
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 5 Region: 399-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.86e-21
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 6 Region: 210-259
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000459
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7EFB2
Sequence length 453
Comment (tr|F7EFB2|F7EFB2_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000009086} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
SVDEQKCMFQESVTFKDVAVNFTQEEWEQLNPAQRNLYKDVMLENYQNLISLGLPISKPD
VIFKLEQGKEPWILNLQEAREREVPRNFSPGGWESHLPLSFFHIYLYPLASSFFLMLSRD
YPSLTESWESRSEIQQSPQHENISEESESPGTLVPLNPTFGEIHISEGRLEKHQKNSEQE
KWKKSLSFENTFKQLSINLTESPSKETDLECKECGKKFFDRPSLTRHLRTHKGEKRYKCN
KCGKAFSKHSSLTEHDRLHTGEKPYECDECGKAFSLKSNLTRHQLTHTGEKPYECDECGK
AFSRRSGLMRHHMTHTGESPYKCYECGKAFFNPSSLTEHERIHTGEKPYECDECGKAFSN
QSSLTVHKRIHTGEKPYECDECGKAFSIHSSLTVHQRIHTGEKPYECDECGKAFFDCSSL
IRHQRTHTGEKPYLCSVCGKVFSSKSSVIQHQR
Download sequence
Identical sequences F7EFB2
ENSMODP00000009086 ENSMODP00000009086 13616.ENSMODP00000009086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]