SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7EJB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7EJB2
Domain Number 1 Region: 26-487
Classification Level Classification E-value
Superfamily ALDH-like 1.96e-92
Family ALDH-like 0.00000274
Further Details:      
 
Domain Number 2 Region: 502-754
Classification Level Classification E-value
Superfamily ALDH-like 1.96e-39
Family ALDH-like 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7EJB2
Sequence length 758
Comment (tr|F7EJB2|F7EJB2_CALJA) Aldehyde dehydrogenase family 16 member A1 {ECO:0000256|PIRNR:PIRNR036490} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=ALDH16A1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MAATRAAPHARELFTSLEYGPVPESHACALAWLDTQDRCLGHYVNGKWLKPEHRNSLPCQ
DPITGESLASCLQAQAEDVAAAVEAARMAFKSWSAQPGVIRGQHLTRLAKVIQKHQRLLW
TLESLVTGRVVREVRDGDVQLAQQLLHYHAIQASTQEEALAGWEPMGVIGLILPPTFSFL
ELMWRICPALAVGCTVVALVPPASPTPLLLAQLAGELGSFPGILNVISGPASLGPILATQ
PAIQKVAFCGALEEGRVLRRSLAGECVELGLALGMESLLLLTDTADMDSAAEGVVDAAWS
DRGPGGLRLLIQESVWDEFMRRLQERMGRLRSGRGLDGAVDMGTRGAAACDLAQRFVHEA
QSQGAQVFQAGDVPPKRPFYPPTLVSNLPPASPCAQAEVPWPVVVASPFRTAKEALAVAN
GTPRGGSASVWSERLGQALELGYGLQMGTVWINAHGLRDPSVPTGGCKESGCSWHGGPDG
LYEYLRPSRTPTQVCCLSKNMSYDTFGLAVPSTLPAGPEIGPSPAPPYGLFIGGRFQAPG
ARSSRPIWDSSGNLHGYVAEGGAKDIRGAVEAAHQASPGWAGQSPGARAGLLWALAAALE
RRKSTLASRLERQGVELKTAEVEVELSARRLRAWGARAQAQGHTLQVSGLRGPVLRLREP
LGVLAVVCPDEWPLLAFVSLLAPALACGNTVVMVPSAACPLLALEVCQDMATLFTAGLAN
VVTGDRDHLTRCLALHQDVQALWYFGSAQGSQFVEWAS
Download sequence
Identical sequences F7EJB2
ENSCJAP00000000140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]