SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7EJZ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7EJZ4
Domain Number 1 Region: 325-623
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.38e-90
Family beta-glycanases 0.000000000267
Further Details:      
 
Domain Number 2 Region: 21-220
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.8e-59
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.000000111
Further Details:      
 
Domain Number 3 Region: 223-324
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 1.06e-28
Family beta-Galactosidase/glucuronidase domain 0.0000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7EJZ4
Sequence length 650
Comment (tr|F7EJZ4|F7EJZ4_MONDO) Beta-glucuronidase {ECO:0000256|RuleBase:RU361154} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=GUSB OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MACWLWVAWVAALGSRALVLAGGMLYPQETPSRERKDLSGLWDFRADFSEDRNQGFRERW
YQSPLRETGPVLDMPVPASFNDVGQDAKLQNFIGWVWYERQVMVPQSWARDPGTRVMLRI
GSAHYYAIVWVNGVHVAEHEGGHLPFEADISRLLRSDAGEPCRVTVAINNTLTPHTLPPG
QIEYKTDRLRYPKNYFIQLTHFDFFNYAGLHRPVFLYTTPASYIEDISVTPEVAQSTGLV
NYEIVVHGSENFELDVLLWDKEGRAVAKGTGARGQLQVPDAQLWWPYLMHEQPAYLYSLE
VTLVVQTGAGTVSDVYTLPVGIRTVTVTHNQFLINGKPFYFHGVNKHEDSDIRGKGFDWA
LLVKDFNLLRWLGANSFRTSHYPYAEEVMQLCDRYGIVVIDEAPGVGIVQWESFGNISLN
HHLEVMEELVQRDKNHPSVVMWSVANEPASWLPPAAYYFKTLIAHTKALDPTRPVTFVSN
SRPEADNGAPYVDVICINSYYSWYHDSGHLEVIQLQVSTTFENWNQLYQKPIIQSEYGAD
AIPGFHQDPPKMFSEEYQKVVLQQYHLALDQKRKDYVIGELIWNFADFMTDQSVMRVMGN
KKGIFTRQRQPKGSAFLLRERYWRIANETRHPHLAMITQCVENQLFYSLN
Download sequence
Identical sequences F7EJZ4
ENSMODP00000008075 XP_001363090.1.35504 ENSMODP00000008075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]