SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7EKT5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7EKT5
Domain Number 1 Region: 245-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000217
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 2 Region: 181-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000314
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 274-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000276
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 137-182
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000945
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7EKT5
Sequence length 744
Comment (tr|F7EKT5|F7EKT5_MONDO) Metal regulatory transcription factor 1 {ECO:0000313|Ensembl:ENSMODP00000022128} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=MTF1 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MGENSPDDNIICYEAEEDELSHHDKMLRFVDKNGLVPSSSGTVYDRTTVLIEQDPSTLED
EDDEGQCGEHLPFFVGGPDEGYHLIDHEGMSQGYVQHIISPDQIHLTINPGSTPMPRNIE
GATLTLQSECPETKRKEVKRYQCTFEGCPRTYSTAGNLRTHQKTHRGEYTFVCNQEGCGK
AFLTSYSLKIHVRVHTKEKPFECDVQGCEKAFNTLYRLKAHQRLHTGKTFNCESEGCSKY
FTTLSDLRKHIRTHTGEKPFRCDHDGCGKAFAASHHLKTHVRTHTGERPFFCPSNGCEKT
FSTQYSLKSHMKGHDNKGHSYNAFPNSMSEDTNHSLCLSDLSLKSKDSELRENSNTTHGQ
DLSTISPAIIFESMFHSPEDTTIQENKQTAALIESFNGDTESVTAVPPSPGDSASLSLPL
VLQPGISEPSQSALPASAPPAPPPTAPSIGTGSQPAAFGTPSAILQPPEGSVAHSTQFAA
NHQEFLPHPQPPQPLVPGLSVVAGAPPVTAAPPTTTEAMPALVQTLPLGATPVLTSNPTI
TITPTPSTAILQSSIVMGDQNLQWILNGATGPPQNQEQIQQASKVEKVFFTTAVPVAGSA
GNSVQQIGLSVPVIIIKQEEACQCQCACRDSAKDRSASSSSRRKGCASPPPPEPGPRVPD
GPSLHLPTQTFPSSSTPLPSSSPPSDNRSRQAENPSDSQTESLSAMDVSEFLSLQSPDTP
SNLIPIEALLQGEEDIGLTSSFAK
Download sequence
Identical sequences F7EKT5
13616.ENSMODP00000022128 ENSMODP00000022128 ENSMODP00000022128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]