SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7ENG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7ENG6
Domain Number 1 Region: 342-386
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000173
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 2 Region: 375-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000125
Family Classic zinc finger, C2H2 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7ENG6
Sequence length 413
Comment (tr|F7ENG6|F7ENG6_MONDO) Kruppel like factor 3 {ECO:0000313|Ensembl:ENSMODP00000025686} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=KLF3 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MIYTPRQPRVPQPLCFLEAMQQQQQQQPHYASERAAPPFLPLGPWAVLQQQTKHQKSILE
DLTKRMLMFDPVPVKQEAMDPVSVSYPSNYIEQMKSNKYSVIYSTPNMLHNKFYPTPEGL
SNGIQMEPVDLTVNKRSSPPSAGSSPSPLKFQTSHRRASPGLTLPSPSPPMKKFTPPPPG
VQPFSVPLSIPPVMAALSRHGIRSPGILPVIQPVVVQPVPFMYASHLQQPIMVSTVLADE
LDNASSMQVPVIESYEKPILQKKIKVEPGIEPQRTDYYPEEMSPPLMNSVSPPQVPLLQE
NHPSVIVQPGKRPLPVESPDTQRKRRIHRCDYEGCNKVYTKSSHLKAHRRTHTGEKPYKC
TWEGCTWKFARSDELTRHFRKHTGIKPFQCPDCDRSFSRSDHLALHRKRHMLV
Download sequence
Identical sequences F7ENG6
ENSMODP00000025686 ENSMODP00000025686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]