SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7EPG2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7EPG2
Domain Number 1 Region: 728-943
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-106
Family Thrombospondin C-terminal domain 0.000000101
Further Details:      
 
Domain Number 2 Region: 601-726
Classification Level Classification E-value
Superfamily TSP type-3 repeat 8.89e-35
Family TSP type-3 repeat 0.00000525
Further Details:      
 
Domain Number 3 Region: 217-262
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 1.31e-17
Family Assembly domain of cartilage oligomeric matrix protein 0.00096
Further Details:      
 
Domain Number 4 Region: 532-603
Classification Level Classification E-value
Superfamily TSP type-3 repeat 8.37e-16
Family TSP type-3 repeat 0.00025
Further Details:      
 
Domain Number 5 Region: 43-154
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000119
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 6 Region: 457-544
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000366
Family TSP type-3 repeat 0.00018
Further Details:      
 
Domain Number 7 Region: 372-412
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000496
Family EGF-type module 0.014
Further Details:      
 
Domain Number 8 Region: 290-344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000385
Family EGF-type module 0.029
Further Details:      
 
Weak hits

Sequence:  F7EPG2
Domain Number - Region: 422-464
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0586
Family EGF-type module 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7EPG2
Sequence length 961
Comment (tr|F7EPG2|F7EPG2_MACMU) Thrombospondin 4 {ECO:0000313|Ensembl:ENSMMUP00000004206} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=THBS4 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MLAPRGAAVLLLHLVLQPWLAAGAQATPQVFDLLPSSSQRVNPGALLPVLTDQALNDLYV
ISTFKLQTKSSATIFGLYSSTDNSKYFEFTVMGRLNKAILRYLKNDGKVHLVVFNNLQLA
DGRRHRLLLRLSNLQRGAGSLELYLDCIQVDSIHNLPRAFAGLSQNPETIELRTFQRKPQ
DFLEELKLVVRGSLFQVASLQDCFLQQSEPLAATGTGDFNRQFLGQMTQLNQLLGEVKDL
LRQQVKETSFLRNTIAECQACGPLKFQSPTPSTVVPPAPPAPPTRPPRRCDSNPCFRGVQ
CTDSRDGFQCGPCPEGYTGNGITCIDVDECKYHPCYPGVRCVNLSPGFRCDACPVGFTGP
MVQGVGISFAKSNKQVCTDIDECRNGACVSNSICINTLGSYRCGPCKPGYTGDQIRGCKM
ERNCRNPELNPCSVNARCIEERQGDVTCVCGVGWAGDGYVCGKDVDIDSYPDEELPCSAR
NCKKDNCKYVPNSGQEDADRDGIGDACDEDADGDGILNEQDNCVLIHNVDQRNSDKDIFG
DACDNCLSVLNNDQKDTDGDGRGDACDDDMDGDGIKNILDNCPRFPNRDQRDKDGDGVGD
ACDSCPDISNPNQSDVDNDLVGDSCDTNQDSDGDGHQDSTDNCPTVINSAQLDTDKDGIG
DECDDDDDNDGIPDLVPPGPDNCRLVPNPAQEDSNSDGVGDICESDFDQDQVIDRIDVCP
ENAEVTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVD
FEGTFHVNTQTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKAVK
SKTGPGEHLRNSLWHTGDTSDQVRLLWKDSRNVGWKDKVSYRWFLQHRPQVGYIRVRFYE
GSELVADSGVTIDTTMRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFQTQNFDRLD
N
Download sequence
Identical sequences A0A2K5V8A0 F7EPG2
XP_005557322.1.63531 XP_014995819.1.72884 ENSMMUP00000004206 9544.ENSMMUP00000004206 ENSMMUP00000004206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]