SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7ERZ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7ERZ3
Domain Number 1 Region: 85-459
Classification Level Classification E-value
Superfamily Serpins 3.53e-89
Family Serpins 0.00000519
Further Details:      
 
Weak hits

Sequence:  F7ERZ3
Domain Number - Region: 28-84
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0018
Family beta-sandwich domain of Sec23/24 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7ERZ3
Sequence length 460
Comment (tr|F7ERZ3|F7ERZ3_MONDO) Serpin family G member 1 {ECO:0000313|Ensembl:ENSMODP00000025122} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=SERPING1 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
EDRGQGNLGLKSISEDFSEYSTESTTQPSTQPPTEPPTQPTSQPTTQPTSQPTTQPTSQP
TTQPTSQPTTQPTSQPTTQAPPEPTCLEPDISCSETETQEAQNMLGAALTDFSLKLYHAF
SSVKKVDSNMVFSPFSIASLLTHILLGAGNTTKGNLKDVLSYPNDFDCVHQALKNLSSSG
FVSASQIFHSPGLALKETFVNASQTLYGSQPMVLSSDNAANLALINSWVANQTNNKITNF
LKNLPSDISLVLLNTIYLQAKWKIMFDPKKSLQESFYLKSSKVKVPMMKSEKYPVTHFTD
PNLKARVGLLQLSNDLSLVILLPRHFGLQLAEVELKLHNPVFSAIMEKLGKIKSYSTLLS
LPRLKVNTSQDLLEILEKMDFFPYDLNLCGLTDDLDVQVSGAHHQTVLELNEAGVEASAA
SSLSLARSMPIFEVNQPFIFLLWHQKYKFPIFMGRIYDPR
Download sequence
Identical sequences F7ERZ3
ENSMODP00000025122 ENSMODP00000025122 13616.ENSMODP00000025122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]