SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7ES70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7ES70
Domain Number 1 Region: 208-298
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000004
Family Ubiquitin-related 0.011
Further Details:      
 
Domain Number 2 Region: 340-365
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000033
Family Ran binding protein zinc finger-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7ES70
Sequence length 410
Comment (tr|F7ES70|F7ES70_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000013146} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=SHARPIN OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MAPPAGGGEEPEGAALEEAVVFVEVRGLGPGSGPGPDGLWRLQLSAEAARPGHFRLALQG
SGSPPGGLQWPLESVTCTSRGPCELELQPPKEGPGPGAVTLCFQDTQDAQRWSTLLERAR
DPAFRGTAAASSASAPTPGILPPSISTPPPASEAESLWSPQDFSEKEDLTNRLTRAICGG
DEQGAAQAAAALAQRQVPLNIVLQESCFPPGPIRLQVTVEDAASSAHISLRVHPHCTVAA
LQEQVFKEYGFPPRVQRWVIGRCLCVPERSLASYGVQRDGDPAFLYLLSGPPGPHGARPS
GRRLEAREKSNGEISSPLTHPPPQASRPPASTNLSGCLQVGWSCPSCTFINVPGRPGCEM
CSTERPAFGSPQPEAPAQQPPKVTRWGEDLAIPPSSGSLDGFLHLSSEFS
Download sequence
Identical sequences F7ES70
ENSMODP00000013146 ENSMODP00000013146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]