SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7EZM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7EZM4
Domain Number 1 Region: 1399-1591,1644-1827,1862-1917
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.23e-112
Family DNA polymerase I 0.000000874
Further Details:      
 
Domain Number 2 Region: 8-181
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 5.23e-41
Family Achaeal helicase C-terminal domain 0.0016
Further Details:      
 
Domain Number 3 Region: 1230-1350
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000834
Family DnaQ-like 3'-5' exonuclease 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7EZM4
Sequence length 1921
Comment (tr|F7EZM4|F7EZM4_CALJA) DNA polymerase theta {ECO:0000313|Ensembl:ENSCJAP00000015705} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=POLQ OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
VTPMFEDWTTIDWYRFFCLWEKLPTSMKRVAELVGVEEGFLARCVKGKVVARTERQHRQM
AIHKRFFTSLVLLDLISEVPLRKIIQKYGCNRGQIQSLQQSAAVYAGMITVFSNRLGWHN
MELLLSQFQKRLTFGIQRELCDLIRVSLLNAPRARVLYASGFLTVADLARANIAEVEMIL
KNAVPFKSARKAVDEEEEAVEERRNMRTIWVTGRKGLTEREAAALIVEEARMILQQDLVE
MGVQWNPYAYSSTCSLTHSESEVKEHTFISQTKSSYKKITSKNENTIFIDSYIKHSPNTV
QDLNKSKEHTSSFNCNFQDGNQEHQKYSIFRARKRASLDINKEKPGASKNEGEISIKKVV
QTFSEKTKKAPLNFSSEKMSRNFQSWKHRKRLKQSRHSSPLKGSGACRINLQGQTLSNSK
LCEDSFSLDENTGCRSSGPFAKNIYLSGVGKDDKTSFTLQIKQSCSLTNDNFVEHFISGS
QSINGTCQVTNVVSEKGRDKAVEVEKINEVLIQNDSKNQNVYVKHHDTHPINRYPQKQSN
EQTSTFIKQKNIIEKQMPCEAVSSYINGDLNVTTVNCERIKLNTEENNPSHFQALGEDIS
RTEIPSGVFLSTRALSKSGGQHENFLNISRLQEKTSDYTTNKNRNNAADSGLVLCDFEDS
FYLDSQSEKIIQQMATESAKLGAEDTSLAAGIRQKSLVKQNLMNSFQNECHITFPAEQHP
LGVKNIDHLNLKTVGPMKQSTDSHGVEILTPESPIFHSPILLEENGLCFKKNELSVTDSQ
LNSFLQVYQTQETVKPVTPLVPQKRTPTGIGECLPVPETSLNMSDSLLFDSFSDDCLVKE
QLSVVQMKKPLPSEEPSNHFSDSLCLHEDLIKKLNVNDNQDIHQQLTFSKYESIFSEMDS
VQMVEALDSADIFPVQEKHRTVVSPRALELSDPVLDGHHQGDQDGGDQDERAEKSILTGT
RQSNSFMWSGASFDLSPGLQMILDKVSSPLENEKLKMTINLSSLNGKNTELNEEQEVNST
LETNQVQENSFSSNNEVKNKIEVPENSANHGETSSLLRIVDDNGLIPPTPIPTSASKLTF
PGILETPVNLQKTKNVLQPGESYLLGSPSDIKNHDLSPERNGFKDNSPISDTSFSLQLSQ
DGLQLTPASSSSESLTIIDVASDRNLFQTFIKEWRCKRQFSISLACEKIRSLTSSKTATI
GGRFKQASSPQETPIRDYGFPVNGCDDILVVGLAVCWGGRDAYYFSLQKEQKHSEISASL
VPPSLDPSLTLKDRIWHLQSCLQKESDEERSVVIYDFIQSYKILLLSCGISLEQSYEDPK
VACWLLDPDSQEPTLHSIVTSFLPHELPLLEGMETSQGIQSLGLNAGSEHSGRYRASVES
ILIFNSMNQLNSLLQKENLQDVFRKVEMPSQYCLALLELNGIGFSTAECESQKHILQAKL
DAIETQAYQLAGHSFSFTSSDDIAEVLFLELKLPPNGEMKNQGSKKTLGSTRRGNDNGRK
LRLGRQFSTSKDVLNKLKALHPLPGLILEWRRITNAITKVVFPLQREKRLNPFLGMERIY
PVSQSHTATGRITFTEPNIQNVPRDFEIKMPTLVGESPPSQAVGKGLLPMGRGKIKKGWS
LNPGCQAQMEERAAERGMPFSVSMRHAFVPFPGGLILAADYSQLELRILAHLSHDRRLIQ
VLNSGADVFRSIAAEWKMIEPESVGDDLRQQAKQICYGIIYGMGAKSLGEQMGIKENDAA
CYIDSFKSRYTGINQFMRETVKNCKRDGFVQTILGRRRYLPGIKENNPYHKAHAERQAIN
TTVQGSAADIVKIATVNIQKQLETFHSTFKSHGHREGMLQSDQTVGLLPKRKLQGMFCPI
RGGFFILQLHDELLYEVAEEDVVQVAQIVKNEMESAVKLSVKLKVKVKIGASWGELKDFD
I
Download sequence
Identical sequences F7EZM4
ENSCJAP00000015705 ENSCJAP00000015705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]