SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7F5J6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7F5J6
Domain Number 1 Region: 56-169
Classification Level Classification E-value
Superfamily PHP domain-like 0.000000000000432
Family RNase P subunit p30 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7F5J6
Sequence length 170
Comment (tr|F7F5J6|F7F5J6_CALJA) Ribonuclease P/MRP subunit p30 {ECO:0000313|Ensembl:ENSCJAP00000020411} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=RPP30 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MAVFADLDLRAGSDVKALRGLVEAAAHRELPWLRGQQRLPSCYPDHRATLGRNYFLMVVA
VNHVVDFKEKKQEIEKPVAVSELFTTLPIVQGKSRPIKILTRLTIIVSDPSHCNVLRATS
SRVRLYDVVAVFPKTEKLFHIACTHLDVDLICITVTEKLPFYFKRPPINV
Download sequence
Identical sequences F7F5J6
ENSCJAP00000020411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]