SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7FDF8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7FDF8
Domain Number 1 Region: 123-329
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000144
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7FDF8
Sequence length 606
Comment (tr|F7FDF8|F7FDF8_MONDO) Scavenger receptor class A member 3 {ECO:0000313|Ensembl:ENSMODP00000019922} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=SCARA3 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
FSVRSTGGDGEALCVAEEEPVGEEEEMPAFPCTQNGKAGPSCSRCQKNLSLHTSVRILYL
FLALLLVAVAVLASLVFKKVDSLSEDISITQSNYEKKIVSVQENLQELDQKALGNCSFCH
DTGQLGQEIHKLQQELEEIQKMLLVQEIQLDQTSQTHQQLFSTSNQITAVVDSCSFSIHQ
VNQTLGQFLAQVRGWQAAMAGLDFSLKGLTQDCYDVKAAVQQINFTVGQTSDWVHMIQRK
TEEETLTLQKMVSEWQNYTRLFSGLRATSAKTGELVKSIQTSLSSASQRINQNSEGIHDL
VLQVMGLQLQLDNVSSFLDDHEENMHDLQYHTRYAQNRTVERFETLEGRMTSHEIEINTI
FTNINATDNHVHSMLKYLDDVRLSCTLGFHTHAEELYYLNKSVSIMLSTTDLLRERFSLL
RARLDFDIQNLSMVMEEMKAVDVRHGAILQNVTILRGIPGPPGPRGLKGDMGVKGPYGSR
GPKGDNGTMGPPGPQGPQGQPGKAGPAGERGPIGFKGFPGLKGSKGSFGSSGLKGQPGPK
GDMGPQGPEGPPGSPGPPGPQGKPGIAGKTGAPGQVGPTGPKGDPGIQGPQGLPGPPGLP
GNQSPY
Download sequence
Identical sequences F7FDF8
13616.ENSMODP00000019922 ENSMODP00000019922 ENSMODP00000019922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]