SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7FMG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7FMG0
Domain Number 1 Region: 150-417
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.65e-37
Family Eukaryotic proteases 0.00032
Further Details:      
 
Domain Number 2 Region: 56-117
Classification Level Classification E-value
Superfamily GLA-domain 2.35e-24
Family GLA-domain 0.00034
Further Details:      
 
Domain Number 3 Region: 106-142
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000242
Family EGF-type module 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7FMG0
Sequence length 417
Comment (tr|F7FMG0|F7FMG0_MONDO) Protein Z, vitamin K dependent plasma glycoprotein {ECO:0000313|Ensembl:ENSMODP00000004881} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=PROZ OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MQLDSSEAAWTIRMVGCFWMLQLCFLAFSLHQSEQSVFWPASKANEVMVRAKRARSFVLE
EILKGNLERECFEEKCAYEEAREVFENNEMTHSFWSQYMDGTPCISQPCLNNGMCQDNIR
NYICSCLEGYEGTNCEYAKNQCHSKRSEGCDHFCRPGQEFYICSCAKGYTLGKDHKSCIP
NEKCACGILSSENNVTLKDAKWTFPWQVKLTNSEGKEFCGGVIVQENFVLTTATCSLIYG
NISVKLSEDSIPGAPMEIKIKNKHVHVRYDQEMGQNNLALLELNEPIQCHSNGLPICIPE
KDFAEHMLIPEKISIVSGWTFNGTELGDSLTYLPSEYFNDEKCEEILNVTVTTRQFCEKS
KTSMDWQLVEGSIVMAEHKGTWFLIGIMAPPPSERPEPVFLFSKISRYSMWFEQVMK
Download sequence
Identical sequences F7FMG0
ENSMODP00000004881 XP_007501312.1.35504 ENSMODP00000004881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]