SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7FRD5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7FRD5
Domain Number 1 Region: 156-227,274-528
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 2.36e-92
Family NadC C-terminal domain-like 0.0000215
Further Details:      
 
Domain Number 2 Region: 46-155
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 1.62e-26
Family NadC N-terminal domain-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7FRD5
Sequence length 573
Comment (tr|F7FRD5|F7FRD5_CALJA) Nicotinate phosphoribosyltransferase {ECO:0000313|Ensembl:ENSCJAP00000039872} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=NAPRT OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
VRAQLLEMEARAAQMARQVQELQPYKASTRARGHRRGWAGVRAGGXXEFELFFRRCPFGG
AFALAAGLRDCVRFLRAFRLLDADVQFLASVLPPDTDPAFFEHLRALDCSEVTVRALPEG
SLAFPGVPLLQVSGPLLVVQLLETPLLCLVSYASLVATNAARLRLIAGPEKRLLEMGLRR
AQGPDGGLTASTYSYLGGFDSSSNVLAGQLRGVPVAGTLAHSFVTSFSGSELPPDPILAP
AAGEGPGVDLAAEAQVWLERVCAHLGLGLQEPHPGERAAFVAYALAFPRAFQGLLDSYSV
RRSGLPNFLAVSLALGELGYRAVGVRLDSGDLLQQAQEIRQVFRTVAAQFQVPWLESVPI
AVSNNIDEEALAQLAQEGSEVNVIGIGTSVVTCPQQPSLGCVYKLVAVAGQPRMKLTEDP
EKQTLPGSKAAFRLLGSDGSLLMDVLQLAEEPVPRAGQELRVWPRGAQEPCTVRPARVEP
LLRLCLQQGQLCEPLPSLAESRALAQLSLSQLSPAHRRLRNPAQYQVGECLPWCPALGAP
TPPTHAPLLCSLQVVLSERLQALVDSLRVGASP
Download sequence
Identical sequences F7FRD5
ENSCJAP00000044543 ENSCJAP00000039872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]