SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7FRV9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7FRV9
Domain Number 1 Region: 75-409
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.24e-80
Family Protein kinases, catalytic subunit 0.00000206
Further Details:      
 
Domain Number 2 Region: 1048-1105
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000148
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0037
Further Details:      
 
Domain Number 3 Region: 1121-1241
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000573
Family Pleckstrin-homology domain (PH domain) 0.03
Further Details:      
 
Domain Number 4 Region: 1273-1526
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.00000562
Family Tricorn protease domain 2 0.028
Further Details:      
 
Weak hits

Sequence:  F7FRV9
Domain Number - Region: 489-583
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0968
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7FRV9
Sequence length 1771
Comment (tr|F7FRV9|F7FRV9_MONDO) Non-specific serine/threonine protein kinase {ECO:0000256|SAAS:SAAS01030073} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=CDC42BPA OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MLYASSFSPHSSDHNRFSVMTNLLMMVLCLPHQTACCALPLQILSAVTPHCCLMRGRGST
KPFTSKVKQMRLHKEDFEILKVIGRGAFGEVAVVKLKNADKVFAMKILNKWEMLKRAETA
CFREERDVLVNGDNKWITTLHYAFQDDNYLYLVMDYYVGGDLLTLLSKFEDRLPEDMARF
YLAEMVIAIDSVHQLHYVHRDIKPDNILMDMNGHIRLADFGSCLKLMEDGTVQSSVAVGT
PDYISPEILQAMEDGKGKYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKER
FQFPVQVTDVSESAKDLIRRLICSREHRLGQNGIDDFKNHPFFAGIDWENIRNCEAPYIP
EVSSPTDTSNFDVDDDCLKNSETMPPPTHTAFSGHHLPFVGFTYTSSCVLSDRSCLRVTA
GPPSMDVDVSIQRTLEDSLATEAYERRIRRLEQEKLELSRKLQESTQTVQALQYSTVDGP
LTANKDLEIKNLKEEIEKLRKQVTDSDHLEQQLEEASSMRRELDDASRQIKASEKQIKLL
KQEREDLNKELVESSERLKSQTKELKDAHSQRKLAMQEFSEMNERLTDLHSQKQKLARQV
RDKEEEMELVMQKVESLRQELRKTERAKKELEVHVESVTAEASKDRKLRERSEQYSKQLE
NELEGLKQKQIGRSPGISSIEHQQEITKLKADLEKKSIFYEEELSKRNVIHTNEIKNLKK
ELRDAEGQQLALKKEIMILKDKLEKTRRESQNEREEFESEFKQKYEREKILLTEENKKLS
NELDKLTAMFERLSINNRQLEEEMRDLADKKESVAHWEAQITEIIQWVSDEKDARGYLQA
LASKMTEELEALRNSSLGTRATDMPWKMRRFAKLDMSARLELQSALDAEIKAKQAIQEEL
NKVKALNISTECKLQESEKKNLELLSEIEKLKKETEELKSEKGVKHQDSQNSFLAFLNAP
TSALDQFERSPSCIPASKGRSIDSVENFTLSNPPSRDEEVKSHLQSRSRSPSTASDIEPI
EITDHPPRSAHTPTMRSAYIGSGISAPKPKAHQLVVKSFNTPTKCNQCTSLMVGLIRQGC
ACEVCGFSCHVTCADKAPAFCPIPPEQTKAPLGIDPQKGVGTAYEGHVRIPKPAGVKKGW
QRALAVVCDFKLFLYDIAEGKTSQPSVIVSQVIDMRDEEFSVSSVLASDVIHASRKDIPC
IFRVTASQLSASSNKCSVLMLADSENEKSKWVCLLNELHRILKKNKLKDRSVYIPKEAYD
STLPLIKTTQAAAIIDHERIALGNEEGLFVVHVTKDEIIRVGDSKKVHQIELIPNEQLIA
VISGRNRHVRLFPMSALDGRETEFFKLAETKGCQTIASGQVRHGALTCLCVAMKRQVLCY
ELNQSKTRHKKIKEIQVLGNVQWMSVFSERLCVGFQSGFLRYPLPGEGNPHSLLHPDDHT
LSFIAQQPTDAICAVEISNKEFLLCFSSVGIYIDCQGRRSRQQELMWPAVPSSCCYNAPY
LSVYSENAVDIFDVNSMEWIQTIPLKKVRPLNSEGSLNLLGLETIRLIYFKNKMAEGDEL
VVPETSDNSRKQMVRNINNKRRYSFRVPEEERMQQRREMLRDPEMRNKLISNPTNFNHIA
HMGPGDGIQILKDLPMNLRPQESRTMFSGSVSIPSITKSRPEPGRSMSASSGLAARSSSQ
NGSALRREFSGGSYGSKRQPMTSPSDGSLSSGGMDQGSDVPARDYDREDSDSPRHSTASN
SSNLSSPPSPISPHKTKSLSLESTDHVSWDT
Download sequence
Identical sequences F7FRV9
ENSMODP00000007747 ENSMODP00000007747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]