SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7FUD7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7FUD7
Domain Number 1 Region: 265-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000103
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 84-211
Classification Level Classification E-value
Superfamily SET domain 0.0000000000000196
Family Histone lysine methyltransferases 0.027
Further Details:      
 
Domain Number 3 Region: 244-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000101
Family Classic zinc finger, C2H2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7FUD7
Sequence length 355
Comment (tr|F7FUD7|F7FUD7_MONDO) PR domain-containing protein 12 {ECO:0000256|PIRNR:PIRNR037163} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=PRDM12 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MMGSVLPAEALVLKTGLKPQGLSLAEVITSDILHSFLYGRWRNVLGEQLFEEKSHHTNPK
TAFTAEVLAQSFSGEVQKLSSLVLPSEVIIAQSSIPGEGLGIFSKTWIKAGTEMGPFTGR
VISPEHVDICKNNNLMWEVFNEDGTVRYFIDASQEDHRSWMTYIKCARNEQEQNLEVVQI
GNSIFYKAIEMIPPDQELLVWYGNSHNTFLGIPGVPGLEEEQKKNKHEDFHPVDTAANTA
GRMRCVICHRGFNSRSNLRSHMRIHTLDKPFVCRFCNRRFSQSSTLRNHVRLHTGERPYK
CQVCQSAYSQLAGLRAHQKSARHRPPNASLQAHSPALPVPHPTSLAAHHIPTMVL
Download sequence
Identical sequences F7FUD7
ENSMODP00000015165 XP_001369688.2.35504 ENSMODP00000015165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]