SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7FXK4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7FXK4
Domain Number 1 Region: 802-911
Classification Level Classification E-value
Superfamily SEA domain 6.54e-19
Family SEA domain 0.01
Further Details:      
 
Domain Number 2 Region: 239-332
Classification Level Classification E-value
Superfamily SEA domain 0.000000301
Family SEA domain 0.0094
Further Details:      
 
Weak hits

Sequence:  F7FXK4
Domain Number - Region: 961-1003
Classification Level Classification E-value
Superfamily EGF/Laminin 0.03
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7FXK4
Sequence length 1138
Comment (tr|F7FXK4|F7FXK4_MONDO) Interphotoreceptor matrix proteoglycan 2 {ECO:0000313|Ensembl:ENSMODP00000037268} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=IMPG2 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
KKMFSFSWKTSLSILIFVLIEGGHQTAQTYLPSGKIQESRVSVSPYRMSLQSSEEKPLDY
RKNKWQRLFRQKRTTLFPNGVKICPDETVAQTVANHLKYFKVRMCQEAVWEVFKTFWDRL
PRREEYGHWMTLCEEGTISIFEMGTNFSQSEEHQSLITKLVLLGREGVSITESSTPVTSY
DSSTLRDTAANASSPRVASFQDFSDSDSERPDDSINNEIETLTETPPKLATEQVAEFIMH
LSGKEYIEELQDPSSRHHQELTQQFISEVEKSFDGLPGYKDIHVLEFRFFFFLLNLSGID
VRYAVTFDSEAISNITWEMINLHSNKVENHGLVERENKPTAVYTINNFRDYIAESLNRNF
VLGNSSLKPDLDSLQFINDVFFPQTEDPLWNVGSPSLLVTQPLILDKTLQAEWPSADESA
ARSSSPLDFTKPGLIFGTLPSTGSELWPKSESPPPDLVSPSKLPLPWKVGSTSPPEVLEG
SSLTLHSVTPAVPQTGLPLAPEKRTSGPVLLGEGPTNVEEPGDFFPFDLLTSNPPSHLVP
MPSVDDSELPLSSLSTLASPSMLDSIDIEITTPFGLDPLASPNKDQLEANIFQPETYPES
GPIFESQSGSGSGHELLPGPWSKPSLHHGTGPPSESWFENEESTVAFVSTNDRLEKIEFS
QEEKPKEILESSSTELSDIDVSTGKSSMELLWTGLSKFNVTQSTTSFPRRPTKDTLASTA
KNIDTLLSRVSISESTKLSPTLSSTNLEDDMIMNVQDISLELDPVGTGYYQPELNQEESS
KMPTNMPSTERAYPNYSQTKGPLVVFFSLRVMNMLFSEDLFNKNSPEYKALEQRFLELLV
PYLQSNLTGFQNLEILNFRNGSIVVNSRVKFAKPVPHDVNNAVYTILEDFCNTAYQTMNL
AIDKYSLDVESGDQADPCKFQACNEFSECVVNRWSGEAECICYPGYQSLQELPCQSVCEL
QPHFCLNDGKCDIIPGHGAICRCRVGENWWYRGEHCEEYMSESQVIGIAVASVIGFLLVV
MAVLFFLAKTLVDQYVKRGRKGSLSRRGDSPSSLENAVRYNPVFESDVTGYDQYGRSYPQ
LTSYSPALGEEPADLSREEIRQLYEHSELSSEEIQERIRMFELYAKDQQFAEFVRQHQ
Download sequence
Identical sequences F7FXK4
ENSMODP00000002418 ENSMODP00000037268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]