SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7G6D3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F7G6D3
Domain Number - Region: 388-434
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0471
Family beta-sandwich domain of Sec23/24 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7G6D3
Sequence length 632
Comment (tr|F7G6D3|F7G6D3_MONDO) Solute carrier family 24 member 4 {ECO:0000313|Ensembl:ENSMODP00000032922} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=SLC24A4 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MAPLPLPPPRRLQGLLQSRKVHRRREMLLHQVGFIGGVLSLVWCATSLLTSLGHETASKG
KHQLPEVWRNRRLMASVNGTQPAKNCTDPAIHEFPTDLFSNKERQHGAVLLHILGALYMF
YALAIVCDDFFVPSLEKICEKLHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVG
TIVGSAVFNILCIIGVCGIFAGQVVNLTWWAVCRDSVYYTLSVIVLIAFIYDEEIVWWEG
LVLIIMYAFYILIMKYNVKMQAFFTIKQKNIANGNTVNSELEDGNDYYDISYDDPSVPLL
WEVKEKPQYGKNPVVMVDEIMSSSPPQFSFPEAGLRIMITNKFGPRTRLRMASRIIINER
QRLINSANGVSKPLQNGRHENIENGNIPMENQEEQQSQQQQQQQQQQQQQEQTEPETTET
DFLSPFSMPEAPMDRAKWIFTWPLIFLLFITIPNCSKPRWEKFFMVTFVFSTLWIAVFSY
LMVWLVTIIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGLGDMAVSNTIGSNVFD
ILVGLGIPWGLQTMEAGKVREKCGYEGLKKTIPQELASETAEVLGIHLNKWRLDKKLGIY
VLVLYAIFLCFSIMIEFNVFTFVNLPMCREDD
Download sequence
Identical sequences F7G6D3
ENSMODP00000032922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]