SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7G6J1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7G6J1
Domain Number 1 Region: 144-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000299
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 2 Region: 115-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000407
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7G6J1
Sequence length 295
Comment (tr|F7G6J1|F7G6J1_MONDO) EGF like domain multiple 8 {ECO:0000313|Ensembl:ENSMODP00000018630} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=EGFL8 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MGSRDRVLLCSLLVGFSVLMLLGGQRLNGDLPFSKGVCSRQTLVVPLRYNESYSQPIYKP
YLTLCAGRRVCSTYRTTYRVAWREVRREVQQIHAICCQGWRKKHPGALTCEEAICAKPCQ
NGGICMQPDQCDCTPGWGGKHCHVDVDECRTGITLCSHSCSNTLGSFICSCPKGLALGSD
GRTCEEIHPEPLPSPSILSLTVREAEKEEHSLRQEIGELRGRLEVLEQWAGHASAWVRAM
LPVSPEAIRPEQVAELWGRGDRIDSLSDQVLLLEEKLGACSCEDNSLGPGLNSRR
Download sequence
Identical sequences F7G6J1
XP_001376525.1.35504 XP_007483667.1.35504 ENSMODP00000018630 ENSMODP00000018630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]