SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7GE85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7GE85
Domain Number 1 Region: 330-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-25
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 386-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.55e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 554-611
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.5e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 752-809
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.59e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 442-499
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 220-276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.93e-23
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 7 Region: 164-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 8 Region: 498-555
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-22
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 9 Region: 596-648
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.97e-20
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 10 Region: 275-331
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.42e-20
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 11 Region: 665-725
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.31e-20
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 12 Region: 77-125
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-17
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 13 Region: 714-753
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000393
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 14 Region: 799-830
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000106
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7GE85
Sequence length 832
Comment (tr|F7GE85|F7GE85_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000014630} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MRVLAPPHCGSLGHAGNLSSAVPTARRCACCSAFGAWLVYEEEVSPSWGSHPLKDHSLNQ
VETPEPEGMAPGTQRPPSQGSIAFKDIVVDFTQEEWCLLDHSQKVLYLKVMLENVQNLLS
VGFPEEEGFMQSHEKSPEMPMHQGNLGEMAVEMVSVSNNGGRPFSLNSKLPAHQIILSGE
KPYECKQCGKAFTQRNNLAAHQRIHTGEKPYECKQCGKAYAWKVSLATHQRIHTGEKPYE
CKQCGKVFTRKYPLAEHERTHTGEKPYKCKHCEKAFTGKDHLAAHQRIHTGEKHECKQCG
KAFTWKLSLTAHQRIHTGEKPYECKQCGNTFTWKISLASHQRIHTGEKPFECKQCGKVFT
WRYSLTAHQRIHTGEKPYECKQCGKAFTGKDHLAAHQRIHTGEKPYECKQCGKAFTWKVS
LATHQRMHTGEKPYECKQCGKTFIWKVSLTAHQRIHTGEKPYECKHCGKFFTRKYPLAEH
ERTHTGEKPYECQYCGKAFIGKCHLAAHLRIHTGEKPYECEHCGKAFTERGSLAKHKNIH
AGEKPYKCKQCGKAFTWKVSFTAHQRIHTGEKPYECKQCGKVFTQRNTLVAHQRIHTGEK
PYECKYCGKAFIGKEQLTAHQRIHTGEKPYECKQCGKAFTWKISLTGHQKIHTRETSYCK
QCGRAFKGKSSLAKHQRIHTREKPYECKQCGKIFILRSSLATHQRMHTGEKPYKPYECKE
CRKAFPERRALAKHQKIHTGEKPYECKQCGKAFTEKGSLTAHQRIHTGEKPYECKQCEKS
FTERGSLAKHLRIHTGEKPYECKQCGKAFKQRSHLAKHQRIHTGEKPFECTQ
Download sequence
Identical sequences F7GE85
ENSMODP00000014630 ENSMODP00000014630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]