SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7GER8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7GER8
Domain Number 1 Region: 233-346
Classification Level Classification E-value
Superfamily TPR-like 0.000000348
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 
Weak hits

Sequence:  F7GER8
Domain Number - Region: 39-74
Classification Level Classification E-value
Superfamily Prefoldin 0.0628
Family Prefoldin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7GER8
Sequence length 346
Comment (tr|F7GER8|F7GER8_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000010528} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
TTMNLSKFLSLSNEFHSIDLQDTVHNEKGAVVVLQKSQFQILEKLNDLLMSVEELKEEIR
FLKEAIPELEKHIRVELRGKTAIHKISPQPRTPRKRKAETGGDISTNNSSEEVESEGGYV
TAQSDTEREHLAGHKANKKTTKRLSLSNLIQKSDDLHLRGDSDKQESFDLLRSYKNKYKS
EIEFIWRLTRAYGDMCDLVTDIEQKRKYASEGKYSVLVKAWHACPSMLEGTALYANLCGC
VAECGGLQNKIKYGQLFKKHLDRAIELIPDEPFLYYLNGRYCYSVFNLNWMEKKMASVLF
GMVPTSSVEEALGNFLKAEELKPGYSKYNYVYLAKCYKDLGQKEKA
Download sequence
Identical sequences F7GER8
ENSMODP00000010528 ENSMODP00000010528 13616.ENSMODP00000010528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]