SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7GGE1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7GGE1
Domain Number 1 Region: 4-280
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 2.43e-104
Family Phosphoglycerate kinase 0.000000000437
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7GGE1
Sequence length 281
Comment (tr|F7GGE1|F7GGE1_CALJA) Phosphoglycerate kinase {ECO:0000256|RuleBase:RU000532} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN= OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MSLSNKLTLDKLDMKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKSVVL
MSHLGRPDGVPCLAILGGAKVAYKIQLINNMLDKVNEMIIGGGMAFTFLKVLNNMEIGTS
LFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDENAKTGQATVAYGIPAGWMGLDY
GPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGCITIIGGGDT
ATCCARWNTEDKVSHVSTGGGARLELLEGKVLPGVDALSNI
Download sequence
Identical sequences F7GGE1
ENSCJAP00000041966 ENSCJAP00000048412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]