SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7GHW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7GHW6
Domain Number 1 Region: 54-835
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.57e-292
Family Motor proteins 1.9e-16
Further Details:      
 
Domain Number 2 Region: 836-961
Classification Level Classification E-value
Superfamily Myosin rod fragments 3.49e-22
Family Myosin rod fragments 0.00032
Further Details:      
 
Domain Number 3 Region: 956-1072
Classification Level Classification E-value
Superfamily Myosin rod fragments 5.93e-21
Family Myosin rod fragments 0.001
Further Details:      
 
Domain Number 4 Region: 1241-1349
Classification Level Classification E-value
Superfamily Myosin rod fragments 4.18e-17
Family Myosin rod fragments 0.0032
Further Details:      
 
Domain Number 5 Region: 1514-1627
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000183
Family Myosin rod fragments 0.0011
Further Details:      
 
Domain Number 6 Region: 1059-1151
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000241
Family Myosin rod fragments 0.0037
Further Details:      
 
Domain Number 7 Region: 1349-1450
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000602
Family Myosin rod fragments 0.0078
Further Details:      
 
Domain Number 8 Region: 1759-1860
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000235
Family Regulator of G-protein signaling, RGS 0.0081
Further Details:      
 
Weak hits

Sequence:  F7GHW6
Domain Number - Region: 27-59
Classification Level Classification E-value
Superfamily Myosin S1 fragment, N-terminal domain 0.00314
Family Myosin S1 fragment, N-terminal domain 0.0013
Further Details:      
 
Domain Number - Region: 1626-1743
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0418
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number - Region: 1157-1231
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0942
Family Myosin rod fragments 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7GHW6
Sequence length 1960
Comment (tr|F7GHW6|F7GHW6_MONDO) Myosin heavy chain 9 {ECO:0000313|Ensembl:ENSMODP00000001289} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=MYH9 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSEKNGFEPASLKEEVGDEAIVELIE
NGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVV
INPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGK
TENTKKVIQYLAYVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIR
INFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKY
RFLSNGHVTIPGQQDKDMFQETMEAMRIMSIPEEEQMGLLKVISGVLQLGNIAFKKERNT
DQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKA
TYERMFRWLVMRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLF
NHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDK
SFVEKVVQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLL
HQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLSKLMAT
LRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQR
YEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKIT
DVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPLLQV
SRQEEEMMAKEEELVKVKEKQLAAENRLTEMETLQSQLMAEKLQLQEQLQAETELCAEAE
ELRARLTAKKQELEEICHDLEARVEEEEERCQHLQTEKKKMQQNIQELEEQLEEEESARQ
KLQLEKVTTEAKLKKLEEDQIILEDQNCKLAKEKKLLEDRISEFTTNLTEEEEKSKSLAK
LKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLNDQIAELQAQIAELKMQLAK
KEEELQAALARVEEEAAQKNMALKKIRELESQISELQEDLESERASRNKAEKQKRDLGEE
LEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLDDEAKTHEAQIQEMRQKHSQAVEE
LAEQLEQTKRVKANLEKAKQALESERAELSNEVKALLQGKGDSEHKRKKVETQLQELQVK
LTEGERVRTELADKVTKLQVELDNITGLLNQSDSKSSKLAKDFSALESQLQDTQELLQEE
TRQKLSLSTKLKQTEDEKGTLREQLEEEEEAKRNLEKQIATLHAQVVDMKKKMDDGVGCL
ESMEETKRRLQKDLEGVSQRYEEKAAAYDKLEKTKTRLQQELDDLLVDLDHQRQIVSNLE
KKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAIEQKAELERLNK
QFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEV
NLQALKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSVAVAARKKLEMDLK
DLEAHIDSANKSRDEAIKQLRKLQAQMKDYMRELDDTRASREEILAQSKENEKKLKSMEA
EMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEE
EQGNTELINDRLKKANLQIDQINTDLNMERSHGQKNENARQQLERQNKELKVKLQEMEST
VKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRAEKKLKDVILQVDDERRNAEQ
YKDQADKVTVRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNK
LRRGDLPFVVPRRVARKGPGECSDEEVDGKADAGDAKATE
Download sequence
Identical sequences F7GHW6
ENSMODP00000001289 XP_001376000.1.35504 ENSMODP00000001289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]