SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7GNV1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7GNV1
Domain Number 1 Region: 113-174
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 3.06e-25
Family Transcriptional factor domain 0.0000534
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7GNV1
Sequence length 439
Comment (tr|F7GNV1|F7GNV1_CALJA) General transcription factor IIE subunit 1 {ECO:0000313|EMBL:JAB03298.1, ECO:0000313|Ensembl:ENSCJAP00000015845} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=GTF2E1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MADPDVLTEVPAALKRLAKYVIRGFYGIEHALALDILIRNPCVKEEDMLELLKFDRKQLR
SVLNNLKGDKFIKCRMRVETAADGKTTRHNYYFINYRTLVNVVKYKLDHMRRRIETDERD
STNRASFKCPVCSSTFTDLEANQLFDPMTGTFRCTFCHTEVEEDESAMPKKDARTLLARF
NEQIEPIYALLRETEDVNLAYEILEPEPTEIPALKQSKDHAATTAVAASLAGGHHREAWT
TKGPSYEDLYTQNVVINMDDQEDLHRASLEGKSAKERPIWLRESTVQGAYSSEDMKEGGI
DMDAFQEREEGRAGPDDNEEVMRALLIHEKKTSSAMAGSVGAAAPVTTANGSDSESETSE
SDDDSPPRPATVAAHQREEDEEEDDEFEEVADDPIVMVAGRPFSYSEVSQRPELVAQMTP
EEKEAYIAMGQRMFEDLFE
Download sequence
Identical sequences F7GNV1
XP_002758809.1.60252 XP_017820692.1.60252 ENSCJAP00000015845 ENSCJAP00000015845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]