SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7GP67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7GP67
Domain Number 1 Region: 18-196
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.66e-73
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000012
Further Details:      
 
Domain Number 2 Region: 191-323
Classification Level Classification E-value
Superfamily E set domains 3.97e-51
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.000000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7GP67
Sequence length 537
Comment (tr|F7GP67|F7GP67_CALJA) RELA proto-oncogene, NF-kB subunit {ECO:0000313|Ensembl:ENSCJAP00000003698} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=RELA OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAINQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLLPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVFMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSSASIPKPGKDFLLSHWSDRFSSI
QPMAEMPSGREMSRGTDLSNRCLKPALLWAYVSQGVGSGDDGDVARTGPYRRVSPPAPQP
YPFSPSLNTINYDEFPTMALLGNSTDPAVFTDLASVDNSEFQQLNQSLPVAPHTAEPMLM
EYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS
Download sequence
Identical sequences F7GP67
ENSCJAP00000003698 ENSCJAP00000003698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]