SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7GPF9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7GPF9
Domain Number 1 Region: 40-293
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.78e-41
Family N-acetyl transferase, NAT 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7GPF9
Sequence length 299
Comment (tr|F7GPF9|F7GPF9_CALJA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCJAP00000015450} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=GLYATL1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
KMILLNNSQKLLALYKSLARSIPESLKVYGSVYHINHGNPFNLEVLVDSWPEYRMVIIRP
QKQEMTDDMDLYTNVYRIFSKEPQKSQEILKNCEIINWKQILQIQGFQGSLGEGIRVAAF
SKSVKVEHSRAILFITEDILNLNASNKSKFGSWAETGHPDVEFESETPDFKYAQLDVSYS
GLVNDRWRRGKNERSLRYIKRCIEALPTACVLGPEGIPVSWVTMDPSCELGMAYSMERYR
KKGKMRQTMVQFKKYLRQNNIPFYLSVLEFNEDSRRSVKQNGFFEAACEWHQWTCYPQI
Download sequence
Identical sequences F7GPF9
ENSCJAP00000015450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]