SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7GXF6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7GXF6
Domain Number 1 Region: 96-197
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.83e-29
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7GXF6
Sequence length 680
Comment (tr|F7GXF6|F7GXF6_CALJA) Hypoxia inducible factor 1 alpha subunit {ECO:0000313|Ensembl:ENSCJAP00000035667} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=HIF1A OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MLTHRNGPVKKGKEQNTQRSFFLRMKCTLTSRGRTMNIKSATWKVLHCTGHIHVYDTNSN
QPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSKTFLSRHSLDMKFSYCDERITELMGYE
PEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQVTTGQYRMLAKRGGYVWVETQATVIYN
TKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECVLKPVESSDMKMTQLFTKVESEDTSSL
FDKLKKEPDALTLLAPAAGDTIISLDFGSNDTETDDQQLEEVPLYNDVMLPSSNEKLQNI
NLSMSPLATSETPKPLRSSADPALNQEVALKLEPNPESLELSFTMPQIQDQPPSPSDGST
RQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKLFAEDTEAKNPFSTQDTDLDLEMLAPYI
PMDDDFQLRSFDQLSPLESSSASPESASPQSTVTVFQQTQIQELTSNATTTTATTDELKT
VTKDRMEDIKILIASPSPTHIHKETTSATSSPYRDTQSRTASPNRAGKGVIEQTEKSHPR
SPNVLSVALSQRATVPEEELNPKILALQNAQRKRKIEHDGSLFQAVGIGTLLQQPDDHAT
TTSLSWKRVKGCKSTEEIEMEFQYVSLCFSDLACRLLGQSMDESGLPQLTSYDCEVNAPI
QGSRNLLQGEELLRALDQVN
Download sequence
Identical sequences F7GXF6
ENSCJAP00000035667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]