SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7GZ81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7GZ81
Domain Number 1 Region: 50-76
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000401
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.05
Further Details:      
 
Weak hits

Sequence:  F7GZ81
Domain Number - Region: 173-198
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0401
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7GZ81
Sequence length 200
Comment (tr|F7GZ81|F7GZ81_CALJA) Hypoxia inducible factor 3 alpha subunit {ECO:0000313|Ensembl:ENSCJAP00000050193} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=HIF3A OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MRPAAGAARRPRCCTSWRTRYPSHVASAPTWTRPLSCASPSATCACTASAPQLELIGHSI
FDFIHPCDQEELQDALTPQQTLSRRKAEAPPTERCFSLRMKSTLTSRGRTLNLKAATWKV
LHCSGHMRAYKPPAQTSPAGSPSSEPPLQCLVLICEAIPHPGSLEPPLGRGAFLSRHSLD
MKFTYCDDRIAEVAGYSPMT
Download sequence
Identical sequences F7GZ81
ENSCJAP00000050193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]