SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7H6D3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7H6D3
Domain Number 1 Region: 21-245
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.36e-65
Family Carbonic anhydrase 0.00000000664
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7H6D3
Sequence length 245
Comment (tr|F7H6D3|F7H6D3_CALJA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCJAP00000020718} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN= OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
FILSLLALMLVRPSRITDSHWCYKTQAEASNYTCLEPDKWGGSCQDCQSPINIVTTKAKV
DEKVGRFFSGYVKKQKWTVQNNGHSLMLLLGNKASISGGGLPARYQATQLHLHWSKWLDE
GSEHSLDEEHFAMEVHIVHEKEKGTSRNEKEAQDPGDKIAVLAFLVEAGPQVNEGFQPLV
EALSNIPKPEMNITMAESSLLDLLPKEDKLKHYFRYLGSLTTPPCDEKVVWTVFQEPIQL
HREQV
Download sequence
Identical sequences F7H6D3
ENSCJAP00000001886 ENSCJAP00000020718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]