SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7HG55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F7HG55
Domain Number - Region: 6-36
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0353
Family RILP dimerisation region 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7HG55
Sequence length 175
Comment (tr|F7HG55|F7HG55_CALJA) Tumor protein D52 like 1 {ECO:0000313|Ensembl:ENSCJAP00000006889} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=TPD52L1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSKSWHD
MQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPAMRNSPTFKS
FEERVETTVTSLKTKVGGMNPNGGSFEEVLSSTAHASAQSLAGGSRRTKEEELQC
Download sequence
Identical sequences F7HG55
XP_008993232.1.60252 ENSCJAP00000006889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]