SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7HHB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7HHB2
Domain Number 1 Region: 54-106
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000467
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7HHB2
Sequence length 153
Comment (tr|F7HHB2|F7HHB2_CALJA) Neuronal PAS domain protein 3 {ECO:0000313|Ensembl:ENSCJAP00000009942} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=NPAS3 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MRDFANQGDPPWNLRMEGPPPNTSVKGAQRRRSPSALAIEVFEAHLGSHILQSLDGFVFA
LNQEGKFLYISETVSIYLGLSQVELTGSSVFDYVHPGDHVEMAEQLGMKLPPGRGLLSQG
TAEDGASSASSSSQSETPEPVVCFSPASDQFPP
Download sequence
Identical sequences F7HHB2
ENSCJAP00000009942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]