SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7HKR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7HKR9
Domain Number 1 Region: 151-557
Classification Level Classification E-value
Superfamily ALDH-like 6.02e-91
Family ALDH-like 0.000000122
Further Details:      
 
Domain Number 2 Region: 2-141
Classification Level Classification E-value
Superfamily Carbamate kinase-like 3.67e-24
Family PyrH-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7HKR9
Sequence length 583
Comment (tr|F7HKR9|F7HKR9_CALJA) Aldehyde dehydrogenase 18 family member A1 {ECO:0000313|Ensembl:ENSCJAP00000029826} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=ALDH18A1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MNIVPIVNTNDAVVPPAEPNSDLQGVNVISVKDNDSLAARLAVEMKTDLLIVLSDVEGLF
DSPPGSDDAKLIDIFYPGDQQSVTFGTKSRVGMGGMEAKVKAALWALQGGTSVVIANGTH
PKVSGHVITDIVEGKKVGTFFSEVKPAGPTVEQQGEMARSGGRMLATLEPEQRAEIIHHL
ADLLTDQRDEILLANKKDLEEAEGRLAAPLLKRLSLSTSKLNSLAIGLRQIAASSQDSVG
RVLRRTRIAKNLELEQVTVPIGVLLVIFESRPDCLPQVAALAIASGNGLLLKGGKEATHS
NRILHLLTQEALSIHGVKEAVQLVNTREEVEDLCRLDKMIDLIIPRGSSQLVRDIQKAAK
GIPVMGHSEGICHMYVDSEASVDKVTRLVRDSKCEYPAACNALETLLIHRDLLRTPLFDQ
IIDMLRVEQVKIHAGPKFASYLTFSPSEVKSLRTEYGDLELCIEVVDNVQDAIDHIHKYG
SSHTDVIVTENENTAEFFLQHVDSACVFWNASTRFSDGYRFGLGAEVGISTSRIHARGPV
GLEGLLTTKWLLRGKDHVVSDFSEHGSLKYLHENLPVPQRNTN
Download sequence
Identical sequences F7HKR9
ENSCJAP00000029826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]