SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7HM00 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7HM00
Domain Number 1 Region: 557-808
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.27e-89
Family Eukaryotic proteases 0.0000923
Further Details:      
 
Domain Number 2 Region: 343-447
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000327
Family Spermadhesin, CUB domain 0.0045
Further Details:      
 
Domain Number 3 Region: 81-168
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000471
Family SEA domain 0.0063
Further Details:      
 
Domain Number 4 Region: 492-523
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 5 Region: 528-567
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000314
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 241-327
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000772
Family Spermadhesin, CUB domain 0.0062
Further Details:      
 
Domain Number 7 Region: 457-490
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000262
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7HM00
Sequence length 809
Comment (tr|F7HM00|F7HM00_MACMU) Transmembrane protease, serine 6 {ECO:0000313|Ensembl:ENSMMUP00000000207} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=TMPRSS6 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MLLLFHSERMPVAKAPQVAGGQGDGGDGEEAEPEGMFEAREDSKRKARGYLRLAPLWLTL
VVLTSVGVLLWYFLGYKAEVTVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQKML
KELIASTRLGTYYNSSSVYSFGEGPLTCFFWFILQIPEHRRLMLSPEVVQALLVEELLST
VNSSAAVPYRAEYEVDPEGLVILEASVKDIAALNSTLGCYRYSYVGQGQVLRLKGPDHLA
SSCLWHLQGPEDLMLKLRLEWTLAECRDRLAMYDVAGPLEKRLITSVYGCSRQEPVVEVL
ASGAIMAVVWKKGLHSYYDPFMLSVQSVVFQACEVNLTLDDRLDSQGVLSTPYFPSYYSP
RTHCSWHLTVPSLDYGLALWFDAYALRRQKYDLPCTQGQWTIQNRRLCGLRILQPYAERI
PVVATAGITINFTSQISLTGPGVRVHYGLYNQSDPCPGEFLCSVNGLCVPACDGVKDCPN
GLDERNCVCRATFQCQEDSTCISLLKVCDGQPDCLNGSDEERCQEGVPCGTFTFQCEDQS
CVKKPNPQCDGRPDCRDGSDEQHCDCGLQGPSSRIVGGAVSSEGEWPWQASLQVRGRHIC
GGALIADRWVITAAHCFQEDSMASPALWTVFLGKVWQNSRWPGEVSFKVSRLLLHPYHEE
DSHDYDVALLQLDHPVVRSAAVRPVCLPARSHFFEPGLHCWITGWGALREGGPTSNALQK
VDVQLIPQDLCSEAYRYQVTPRMLCAGYRKGKKDACQGDSGGPLVCKALSGRWFLAGLVS
WGLGCGRPNYFGVYTRITGVIGWIQQVVT
Download sequence
Identical sequences F7HM00
ENSMMUP00000000206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]