SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7HSA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7HSA2
Domain Number 1 Region: 28-289
Classification Level Classification E-value
Superfamily Carbonic anhydrase 9.03e-80
Family Carbonic anhydrase 0.00000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7HSA2
Sequence length 290
Comment (tr|F7HSA2|F7HSA2_MACMU) Carbonic anhydrase-related protein {ECO:0000313|EMBL:AFE80044.1} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_18981 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREAR
YDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWG
RENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLK
AVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPL
TISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ
Download sequence
Identical sequences A0A096MSS8 A0A2K5HGS8 A0A2K5M8H4 A0A2K6A0H9 A0A2K6BB44 A0A2K6LEJ6 A0A2K6PKI2 F7HSA2 G1QN06 G7PBW7 H2QW78 I3MB31 P35219
ENSNLEP00000002322 ENSPTRP00000034722 ENSPANP00000002848 ENSP00000314407 ENSPTRP00000034722 9544.ENSMMUP00000008482 9598.ENSPTRP00000034722 9606.ENSP00000314407 ENSNLEP00000002322 ENSP00000314407 GO.57446 HR3028 ENSMMUP00000008482 NP_001248224.1.72884 NP_001308766.1.87134 NP_001308766.1.92137 NP_004047.3.87134 NP_004047.3.92137 XP_003256066.1.23891 XP_005323034.1.77405 XP_005563441.1.63531 XP_010358649.1.97406 XP_011740566.1.29376 XP_011787339.1.43180 XP_011837565.1.47321 XP_011947324.1.92194 XP_015341334.1.40921 XP_016814995.1.37143 XP_017743093.1.44346 XP_519778.2.37143 gi|22027500|ref|NP_004047.3| ENSP00000314407 ENSMMUP00000008482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]