SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7HX35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7HX35
Domain Number 1 Region: 47-129
Classification Level Classification E-value
Superfamily FKBP-like 7.2e-20
Family FKBP immunophilin/proline isomerase 0.00000511
Further Details:      
 
Domain Number 2 Region: 2-39
Classification Level Classification E-value
Superfamily WW domain 0.000000000000757
Family WW domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7HX35
Sequence length 145
Comment (tr|F7HX35|F7HX35_CALJA) Peptidyl-prolyl cis-trans isomerase {ECO:0000256|RuleBase:RU363014} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=PIN1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGAQGMGFTRSGDPLLPKG
Download sequence
Identical sequences F7HX35
ENSCJAP00000011195 ENSCJAP00000011195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]