SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7HXZ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7HXZ4
Domain Number 1 Region: 10-190
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.6e-42
Family G proteins 0.000029
Further Details:      
 
Domain Number 2 Region: 190-229
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000798
Family SOCS box-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7HXZ4
Sequence length 282
Comment (tr|F7HXZ4|F7HXZ4_CALJA) RAB40C, member RAS oncogene family {ECO:0000313|Ensembl:ENSCJAP00000052184} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=RAB40C OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MGSQGSPVKSYDYLLKFLLVGDSDVGKGEILESLQDGAAESPYAYSNGRIDYKTTTILLD
GRRVKLELWDTSGQGRFCTIFRSYSRGAQGILLVYDITNRWSFDGIDRWIKEIDEHAPGV
PRILVGNRLHLAFKRQVPTEQARAYAEKNCMTFFEVSPLCNFNVIESFTELSRIVLMRHG
MEKIWRPNRVFSLQDLCCRAIVSCTPVHLIDKLPLPVTIKSHLKSFSMANGMNAVMMHGR
SYSLASGAGSGGSKGNSLKRSKSIRPPQSPPQNCSRSNCKIS
Download sequence
Identical sequences F7HXZ4
ENSCJAP00000052184 ENSCJAP00000052184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]