SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7HZS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7HZS8
Domain Number 1 Region: 7-486
Classification Level Classification E-value
Superfamily ALDH-like 2.09e-161
Family ALDH-like 0.0000000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7HZS8
Sequence length 487
Comment (tr|F7HZS8|F7HZS8_CALJA) Aldehyde dehydrogenase 8 family member A1 {ECO:0000313|Ensembl:ENSCJAP00000014652} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=ALDH8A1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MAATKALLMLENFIDGKFLPCSSYIDSYDPSTGEVYCRVPNSGKDEIEAAVKAAREAFPG
WSSRSPQERSRVLNQVADLLEQSLEEFAQAESKDQGKTLALARTMDIPRSVQNFRFFASS
ILHHISECTQMDHLGCMHYTVRTPVGVAGLISPWNLPLYLLTWKIAPAMAAGNTVIAKPS
ELTSVTAWMLCRLLDEAGVPPGVVNIVFGTGPRVGEALVSHPEVPLISFTGSQPTAERIT
QLSAPHCKKLSLELGGKNPAIIFEDANLDECVPATVRSSFANQGEICLCTSRIFVQKSIY
REFLKRFVEATREWKVGIPSDPLASMGALISKAHLEKVRSYVKKALAEGAQIQCGEGVDK
LSLPARNQAGYFMLPTVITDIRDESCCMTEEIFGPVTCVVPFDSEEEVIERANSLKYGLA
AVVWSSNVGRVHRVAKKLQSGLVWTNCWLIRELNLPFGGMKSSGIGREGAKDSYDFFTEI
KTITIKH
Download sequence
Identical sequences F7HZS8
XP_002747097.1.60252 ENSCJAP00000014208 ENSCJAP00000014652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]