SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7HZT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7HZT8
Domain Number 1 Region: 2-87
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.22e-20
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7HZT8
Sequence length 354
Comment (tr|F7HZT8|F7HZT8_CALJA) Single-minded family bHLH transcription factor 2 {ECO:0000313|Ensembl:ENSCJAP00000002674} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=SIM2 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
RVTEVTGYEPQDLIEKTLYHHVHGCDVFHLRYAHHLLLVKGQVTTKYYRLLSKRGGWVWV
QSYATVVHNSRSSRPHCIVSVNYVLTEIEYKELQLSLEQVSTKSQDSWRTALSTSQESRI
TNPKYQDEDKLKQRLPPQTNPYPPQQYSSFQMDKLECGQLGNWRASPPASTPAPPEPQLH
SESSDLLYAPSYSLPFSYHYGHFPLDSHVFSSKKPMLPAKFGQPQGSPCEVARFFLSTLP
ASGECQWHYANPLVPSSSSPAKNPPEPPVNTARHSLMPSYEGGATATPRMERDTPPSFPS
CHYREEPTLGPVKDARSARDRALVLACAASECCSLPVLEPPGAQEHLPFVLINY
Download sequence
Identical sequences F7HZT8
ENSCJAP00000002674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]