SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7I168 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7I168
Domain Number 1 Region: 12-102
Classification Level Classification E-value
Superfamily POZ domain 5.49e-22
Family Tetramerization domain of potassium channels 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7I168
Sequence length 223
Comment (tr|F7I168|F7I168_CALJA) Potassium channel tetramerization domain containing 18 {ECO:0000313|Ensembl:ENSCJAP00000046971} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=KCTD18 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MEGHEAEEEVLDILRLNVGGCVYTARRESLCRFKDSMLASMFSGRFPLKTDESGACVIDR
DGRLFKYLLDYLHGEVQIPTDEQTRIALQEEADYFGIPYPYSLSDHLANEMETYSLRSNI
ELKKALTDFCDSYGLVCNKPTVWVLHYLNTSGASCESRIIGVYATKNDGTDAIDKQLGGR
IHSKSIFKREAGNNVQYIWSYYSVAELKKMMDAFDAWEGKGTV
Download sequence
Identical sequences F7I168
ENSCJAP00000046971 ENSCJAP00000046971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]