SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7I1G6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7I1G6
Domain Number 1 Region: 131-215
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000236
Family HLH, helix-loop-helix DNA-binding domain 0.0000374
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7I1G6
Sequence length 295
Comment (tr|F7I1G6|F7I1G6_CALJA) Max-interacting protein 1 isoform b {ECO:0000313|EMBL:JAB21857.1} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=MXI1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MGKRGRPRKEARCEGAGLAPAAPPAVPPAVAAPQTPALPEEPAGAKPRCPFSDIFNTSEN
SMEKHINTFLQNVQILLEAASYLEQIEKENKKCEHGYASSFASMPSPRLQHSKPPRRLSR
AQKHSSGSSNTSTANRSTHNELEKNRRAHLRLCLERLKVLIPLGPDCTRHTTLGLLNKAK
AHIKKLEEAERKSQHQLENLEREQRFLKRRLEQLQGPQEMERIRMDSIGSTISSDRSDSE
REEIEVDVESTEFSHGEVDNISTTSISDIDDHSSLQSIGSDEGYSSASVKLSFTS
Download sequence
Identical sequences F7I1G6
XP_002756634.1.60252 ENSCJAP00000034583 ENSCJAP00000034593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]