SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7I451 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7I451
Domain Number 1 Region: 4-479
Classification Level Classification E-value
Superfamily ALDH-like 1.57e-155
Family ALDH-like 0.000000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7I451
Sequence length 481
Comment (tr|F7I451|F7I451_CALJA) Aldehyde dehydrogenase 5 family member A1 {ECO:0000313|Ensembl:ENSCJAP00000011149} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=ALDH5A1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
WLPDAKTIPVKDPDNGASLGMMNDCGVPEEHAAVRAAYEAFCSWKRDSAKERSSLLRKWY
DLMIKNKDDLAKIITAESGKPLKEAQGEILYSALFLEWFSEEARRVYGDIIYTSARDKRS
LVLKQPVGVAAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALALAEILYAFV
VYRDIILLLANQAGIPPGVYNVIPCSRKNAKEVGEVICTDPLVSKISFTGSTTTGKVLLH
HAANSVKRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNRFLVQRGIHD
AFVKAFAEAMKKNLRVGNGFEEGTTQGPLINEKAVEKVEKQVNDAVCKGATIVTGGKRHQ
LGKNFFEPTLLSNVTQDMLCSHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQD
PAQIWRVAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLELKYVCYGG
L
Download sequence
Identical sequences F7I451
ENSCJAP00000011149 ENSCJAP00000011149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]