SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7I4E0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7I4E0
Domain Number 1 Region: 363-464
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.91e-17
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7I4E0
Sequence length 1294
Comment (tr|F7I4E0|F7I4E0_CALJA) Period circadian regulator 1 {ECO:0000313|Ensembl:ENSCJAP00000026847} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=PER1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MSGPLEGADGGGDPSPGESFCPGGVPSPGPPQHRPCPGPSLADDTDANSNGSSGNESNGH
ESRGASQRSSHSSSSGNGKDSALLETTESSKSTNSQSPSPPSSSIAYSLLSASSEQDNPS
TSGCRLCSSEQSARARTQKELMTALRELKLRLPPERRGKGRSGTLATLQYALACVKQVQA
NQEYYQQWSLEEGEPCSMDMSTYTLEELEHITSEYTLRNQDTFSVAVSFLTGRIVYISEQ
AAILLRCKRDVFRGTRFSELLAPQDVGVFYGSTAPSRLPTWGTGASAGSGLRDFTQEKSV
FCRIRGGPDRDLGPRYQPFRLTPYVTKIRVSDGAPAQPCCLLIAERIHSGYEAPRIPPDK
RIFTTRHTPSCLFQDVDERAAPLLGYLPQDLLGAPVLLFLHPEDRPLMLAIHKKILQLAG
QPFDHSPIRFCARNGEYVTMDTSWAGFVHPWSRKVAFVLGRHKVRTAPLNEDVFTPPAPS
PVLPLDTDIQELSEQIHRLLLQPVHSPSSTGFSGVGPMTSPGPLHSPGSSSDSNGGDAEG
PGPPAPVTFQQICKDVHLVKHQGQQLFIESRAWPQPRTRLPATGTFKAKTLPCQSPDPEL
ETGPAPIQAPLALAPEEAERKEASSSSYQQINCLDSILRYLESCNIPSTTKRKCASSSSY
TTSSASDDDKQRTGPVPVGTKKDPPSAVLSGEGATPRKEPVVGGTLSPLTLANKAESVVS
ATSQCSFSSTIVHVGDKKLPESGVIPVEFLAGSSQGRGLSICCSPGTALHGEEDAYRPVG
LTKAVLSLHTQKEEQAFLSRFRDLGRLRGLDSSSTAPSALSLSTGCHHSPAPQSRRHHCR
SKAKRSRHHQNPRAETPCYVSHPSPVPPSTPWPPPPATTPFPAVVQPYPLQVFSPRGGPQ
PLPPAPTSVPQAAFPTPLVTPMVALVLPNYLFPTSSSYPYGAPQTPAEGPATASHSPSPS
LPALPPSPPRGPDSPLFNSRCSSPLQLNLLQLEESPRAEGAAVAGGPGSSAGPPPPNEKA
AEPEARLVEVTESSNQDALSGSSDLLELLLQEDSRSGTGSAASGSLGSGLGSGSGSGSHE
GCSTSASITRSSQSSHTSKYFGSIDSSEAEAGAARAEAEPGDQVIKYVLQDPIWLLMANA
DQRVMMTYQVPSRDMTSVLKQDRERLRAMQKQQPRFSEDQRRELGAVHSWVRKGQLPRAL
DVMACVDCGSSTQDPGHPDDPLFELDGLGLEPMEEGGGEQGSSGGGSGEGEGCEEAGAQV
GAKASSSQDLAMEEEEEGRSSASPALPTAGNSAS
Download sequence
Identical sequences F7I4E0
ENSCJAP00000026853 ENSCJAP00000026847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]