SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7I5U9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7I5U9
Domain Number 1 Region: 18-106
Classification Level Classification E-value
Superfamily Kringle-like 3.32e-38
Family Kringle modules 0.0000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7I5U9
Sequence length 106
Comment (tr|F7I5U9|F7I5U9_CALJA) Plasminogen {ECO:0000313|Ensembl:ENSCJAP00000046939} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=PLG OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MGHKEVILLLLLFLKSATPPPLSGPTYQCLKGTGENYRGNVAVTVSGHTCQRWSAQTPHK
HNKTPENFPCKNLDENYCRNPDGEKAPWCYTTNSQERWEYCNIPSC
Download sequence
Identical sequences F7I5U9
ENSCJAP00000046939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]